PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g57567.1.p
Common NameBRADI_3g57567, LOC100825927
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family HD-ZIP
Protein Properties Length: 714aa    MW: 77188.4 Da    PI: 6.5058
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g57567.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.53e-202277156
                      TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                      +++ +++t+ q+++Le+ F+++++p++++r +L+++lgL+ rq+k+WFqNrR+++k
  Bradi3g57567.1.p 22 KKRYHRHTPRQIQQLEATFKECPHPDENQRMHLSRELGLEPRQIKFWFQNRRTQMK 77
                      678899***********************************************998 PP

2START134.31.3e-422204543205
                       HHHHHHHHHHHHHHC-TT-EEEE.........EXCCTTEEEEEEESSS...SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEE CS
             START   3 aeeaaqelvkkalaeepgWvkss.........esengdevlqkfeeskv..dsgealrasgvvdmvlallveellddkeqWdetla....kae 80 
                       a +a++el+++a+a++ +W k           + + +d+v  k+  s++   ++e +r+s +v  +++ lv +++d++ +W   ++    ka 
  Bradi3g57567.1.p 220 ATRAMDELIRLAQAGDHVWAKADnggccrevlSVDAYDTVFGKPGGSRGpdVHVEGSRDSCLVLLPAHALVDIFMDSS-KWADFFPtivaKAR 311
                       6789*****************9999999999999999999999966666999**************************.**999999999*** PP

                       EEEEECTT.....EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.........-TTSEE-EESSEEEEEEEECT CS
             START  81 tlevissg.....galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe........sssvvRaellpSgiliepksn 159
                       t++v+ sg     + l+lm+ el +++p+vp R+  f+Ry+rq ++g w+++dvSvd  q++           ++ +Ra++lpSg+li ++sn
  Bradi3g57567.1.p 312 TVDVLVSGmagrsESLVLMQEELHVMTPVVPtRELCFLRYCRQIEQGLWAVADVSVDLLQQRDHaaasryygAPPQARARKLPSGCLIADMSN 404
                       *********************************************************99999877765566667889**************** PP

                       CEEEEEEEE-EE--S...SXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
             START 160 ghskvtwvehvdlkg...rlp.hwllrslvksglaegaktwvatlqrqce 205
                       g+skvtwveh++  +   + p   l+r lv sg+a+ga +w+a+lqr c 
  Bradi3g57567.1.p 405 GYSKVTWVEHMETTEgdnKNPiNPLYRDLVLSGAAFGAHRWLAALQRACD 454
                       **********98854122455699***********************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.71E-201479IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.0E-211984IPR009057Homeodomain-like
PROSITE profilePS5007117.8641979IPR001356Homeobox domain
SMARTSM003892.7E-192083IPR001356Homeobox domain
CDDcd000861.72E-192180No hitNo description
PfamPF000469.0E-182277IPR001356Homeobox domain
PROSITE patternPS0002705477IPR017970Homeobox, conserved site
PROSITE profilePS5084842.662209458IPR002913START domain
SuperFamilySSF559613.44E-28210456No hitNo description
CDDcd088752.96E-98213453No hitNo description
SMARTSM002342.0E-27218455IPR002913START domain
PfamPF018528.8E-36220454IPR002913START domain
SuperFamilySSF559614.21E-17476703No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009828Biological Processplant-type cell wall loosening
GO:0010091Biological Processtrichome branching
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 714 aa     Download sequence    Send to blast
MEYGDDLAVA AGSDAAVAQR RKKRYHRHTP RQIQQLEATF KECPHPDENQ RMHLSRELGL  60
EPRQIKFWFQ NRRTQMKAQH ERADNCFLRA ENDKIRCENI AMREALKNVI CPTCGGPHTN  120
DDYFDEHKLR MENAHLKEEL DRVSSLTSKY LGRPITQLPS SMQQSLSMSS LDLSMGAAAA  180
AMGGPSLDLD LLSGGGSSSG MPAAFQPVSD MERPMMADMA TRAMDELIRL AQAGDHVWAK  240
ADNGGCCREV LSVDAYDTVF GKPGGSRGPD VHVEGSRDSC LVLLPAHALV DIFMDSSKWA  300
DFFPTIVAKA RTVDVLVSGM AGRSESLVLM QEELHVMTPV VPTRELCFLR YCRQIEQGLW  360
AVADVSVDLL QQRDHAAASR YYGAPPQARA RKLPSGCLIA DMSNGYSKVT WVEHMETTEG  420
DNKNPINPLY RDLVLSGAAF GAHRWLAALQ RACDRHACLV AASMPHRDIA AGVTAEGKRS  480
MMRLSERMVS SFCGSLSASQ AHRWTTLSGP GSSGGGGDDV GVRVMVHRST DPGQPNGVVL  540
SAATSIWLPV PCDRVYAFVR DENTRSQWDV LSHGNPVQEV SRIPNGSHPA ASSISLLRGL  600
NASQNSMLIL QESSTDATGS QVVYAPIDLP AANVVMSGED PSAIPLLPSG FTILPDGSGG  660
PGSGSLVTVA FQILVSSLPS SRLNEESVAT VNSLIGTTVE QIKAALNCST TTH*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00232DAPTransfer from AT1G73360Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003570542.10.0PREDICTED: homeobox-leucine zipper protein ROC8-like
SwissprotQ69T580.0ROC8_ORYSJ; Homeobox-leucine zipper protein ROC8
TrEMBLI1IEQ30.0I1IEQ3_BRADI; Uncharacterized protein
STRINGBRADI3G57567.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29123770
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G05230.30.0homeodomain GLABROUS 2